Tujuan Kebijakan Perpajakan Internasional

Tujuan Kebijakan Perpajakan Internasional

Tujuan Kebijakan Perpajakan Internasional

Setiap kebijakan tentu mempunyai tujuan khusus yang ingin dicapai, begitu juga dengan kebijakan perpajakan internasional juga mempunyai tujuan yang ingin dicapai yaitu memajukan perdagangan antar negara, mendorong laju investasi di masing-masing negara, pemerintah berusaha untuk meminimalkan pajak yang menghambat perdagangan dan investasi tersebut. Salah satu upaya untuk meminimalkan beban tersebut adalah dengan melakukan penghindaraan Pajak Berganda Internasional.


Tujuan P3B antara lain:


  1. Tidak terjadi pemajakan ganda yang memberatkan iklim usaha dunia


  1. Peningkatan investasi modal dari luar negeri ke dalam negeri


  1. Peningkatan sumber daya manusia


  1. Pertukaran informasi untuk mencegah penghindaran pajak


  1. Keadilan dalam hal pemajakan penduduk dari negara yang terlibat dalam perjanjian.

Prinsip-prinsip yang harus dipahami dalam pemajakan internasional


Doernberg (1989) menyebut 3 unsur netralitas yang harus dipenuhi dalam kebijakan pemajakan internasional:


  1. Capital Export Neutrality (Netralitas Pasar Domestik) artinya kemanapun kita berinvestasi, beban pajak yang dibayar adalah sama. Sehingga tidak ada perbedaan apabila kita berinvestasi di dalam atau luar negeri. Oleh karena itu, hal yang perlu dihindari apabila berinvestasi di luar negeri adalah beban pajak yang lebih besar. Hal ini disebabkan karena adanya beban pajak di dua negara tersebut.
  2. Capital Import Neutrality (Netralitas Pasar Internasional artinya darimanapun investasi yang kita lakukan berasal, akan dikenakan pajak yang sama. Sehingga apabila berinvestasi di suatu negara, investor dari dalam negeri atau luar negeri akan dikenakan tarif pajak yang sama.
  3. National Neutrality artinya setiap negara, mempunyai bagian pajak atas penghasilan yang sama. Sehingga apabila terdapat pajak luar negeri yang tidak bisa dikreditkan dapat  dikurangkan sebagai biaya pengurang laba.


Aspek Perpajakan Internasional Dalam Undang-undang Pajak Penghasilan


Indonesia sebagai Negara berdaulat memiliki hak untuk membuat ketentuan tentang perpajakan. Fungsi dari pajak yang ditarik oleh pemerintah ini utamanya adalah untuk membiayai kegiatan pemerintahan dalam rangka menyediakan barang dan jasa publik yang diperlukan oleh seluruh rakyat Indonesia. Di samping itu, pajak juga berfungsi untuk mengatur perilaku warga Negara untuk melakukan atau tidak melakukan sesuatu.


Salah satu jenis pajak yang berlaku di Indonesia dan memiliki peranan penting dalam penerimaan negara adalah Pajak Penghasilan (PPh) yang pertama kali diberlakukan pada tahun 1984 berdasarkan Undang-undang Nomor 7 Tahun 1983.


Pajak Penghasilan adalah pajak subjektif di mana jenis pajak ini bisa dikenakan apabila syarat subjektif dan objektif terpenuhi bagi orang atau badan. Pada umumnya hampir semua orang atau badan di Indonesia akan memenihi syarat subjektif dan jika  orang atau badan ini memperoleh penghasilan maka syarat objektif juga terpenuhi.

Sumber :


Manfaat Media PembelajaranBerbentuk Jam

Manfaat Media PembelajaranBerbentuk Jam

Manfaat Media PembelajaranBerbentuk Jam

Memilikibeberapamanfaatyang dapatmengembangkankemampuanpesertadidikkhususnyaanakusiadinidalam proses kegiatanbelajarmenggunakan jam sebagai media pembelajarnya, diantaranya :

  1. a)

Melalui media iniakandapatmembantuanakuntukdapatmengenalberbagaimacamwarna, berbagaiwarna-warna yang menarik yang adadalam jam akandapatanakketahui. Serta anakdapatbelajarangka-angka yang adapada jam, di karenakan media yang di gunakanpadasaatiniadalah jam, makaangka yang dapatanakketahuiayaitu yang menunjukkanpada jam, yakni 1 – 12. Sehinggadalamhalinikemampuankognitifnyaakanlebihbaiklagi.

  1. b)Belajarberhitung

Jam yang di gunakansebagai media pembelajaranini, akandapatmembantukemampuananakuntukberhitung. Dalam media ini, setiapangkaakanadabenda-benda yang menyatakanjumlahnya. Misalpadaangka 12, makaakanadapensil yang menyatakanjumlahsesuaidenganangka 12, dankemudiandapatanakhitungjumlahnyaitu. Dalamkegiataninikemampuankognitifanakdapatjugadikembangkan.

  1. c)Dapatbelajarmengetahuinamabenda, hewandanbuah

Seperti yang telahdijelaskanpadamanfaatsebelumnya, bahwasetiapangkaadaberbagaimacamgambarbenda-benda, hewansertabuah-buahan yang jumlahnyasesuiadenganangkatersebut.Sehinggaakanmembantuanakuntukmengenalberbagaimacamgambarbenda, hewan, danbuah, sepertigambaradagambarpensil, tas, bebek, kupu-kupu, pisang, jeruk, dan lain-lain.

  1. d)Mengembangkankemampuanbahasaanak

Melalui media jam ini, makaanakdapatmenyebutkanberbagaimacamangkasertaberbagaimacamgambar yang ada, secaratidaklangsungakandapatmelatihkemampuanberbahasaanakmenjadilebihbaiklagi.

  1. e)Mengembangkankemampuanmotorikanak

Karena media yang digunakanadalah jam, makatidakterlepasdari yang namanyajarum jam sebagaipenunjukwaktu. Anakdapatmemainkanjarum jam tersebutdengancaramemutar-mutarkannya, sehinggadalamhalinikelenturanjari-jarianakakanlebihbaiklagi, bisajugadengancaraanakmenggambarkandanmewarnaigambarapasaja yang merekasukai yang adapadajam tersebut, untukdapatmelatihkemampuanmotoriknya.

  1. f)Belajarmengenalwaktumelalui jam

Kita jugadapatmengenalkanwaktupadaanak, tidakhanyasekedarwaktupagi, siangdanmalamsaja.Namundalamhalinikitadapatmenyertakanwaktutersebutdenganjamnya.Misalpada jam 06.00 adalahpagidanwaktunyautukbanguntidurlalumandi.

  1. g)Meningkatkandayafikirdanimajinasianak

Melalui media inianakdapatmengembangkandayafikirnyasertaanakmulaibelajarberfikirabstrak, sehinggaimajinasinyaakanmeningkat.



3.1        Kesimpulan

Pengertian media dalampembelajaranadalahsegalabentukalatkomunikatif yang dapatdigunakanuntukmenyampaikanpesan/informasidarisumberkepadaanakdidikyanngbertujuan agar dapatmerangsangpikiran, perasaan, minatdanperhatiananakdidikuntukmengikutikegiatanpembelajaran.

Peran media dalam proses belajarmengajaradalah; a) MemperjelasPenyajianPesandanMengurangiVerbalitas; b) MemperdalamPemahamanAnakDidikterhadapMateriPelajaran; c) MemperagakanPengertian yang AbstrakkepadaPengertian yang KoonkretdanJelas; d) MengatasiKeterbatasanRuang, WaktudanDayaInderaManusia.

Manfaat media pembelajaranmenggunakan jam, diantaranya; a)mengenalkonsepwarnadanangka; b)  belajarberhitung; c) dapatbelajarmengetahuinamabenda, hewandanbuah; d) mengembangkankemampuanbahasa; e) mengembangkankemampuanmotorik; f) belajarmengenalwaktumelalui jam; g) meningkatkandaya piker anakdanimajinasianak.

Sumber :





            Merupakan penyakit jamur yang bersifat akut atau subakut disebabkan oleh spesies Candida albicans dan dapat mengenai mulut, vagina, kulit, kuku, bronki atau paru, kadang-kadang dapat menyebabkan septicemia, endokarditis, atau meningitis.

Pencegahan :

  • Pencegahan primordial :

Menjaga kebersihan lingkungan.

  • Pencegahan primer :

Menjaga kebersihan diri.

  • Pencegahan sekunder :

Pengobatan yang dapat dilakukan :

  1. Menghindari atau menghilangkan factor predisposisi.
  1. Topikal :

–          Larutan ungu gentian ½-1% untuk selaput lendir, 1-2% untuk kulit, dioleskan sehari 2 kali selama 3 hari.

–          Nistatin : berupa krim, salap, emulsi.

–          Amfoterisin B

–          Grup azol antara lain :

Mikonazol 2% berupa krim atau bedak.

Klotrimazol 1% berupa bedak, larutan dank rim.

Tiokonazol, bufonazol, isokonazol

Siklopiroksolamin 1% larutan, krim

Antimikotik yang lain yang berspektrum luas.

  1. Sistemik

–         Tablet nistatin  untuk menghilangkan infeksi local dalam saluran cerna, obat ini tidak diserap dalam usus.

–        Amfoterisin B diberikan i.v untuk kandidosis sistemik.

–         Untuk kandidosis vaginalis dapat diberikan kotrimazol 500 gr per vaginam dosis tunggal

–         Itrakonazol: bila dipakai untuk kandidosis vulvovaginalis dosis untuk orang dewasa 2 x 100 mg sehari, selama 3 hari.

 Tanda dan Gejala :

Gejala kandidiasis dapat bervariasi tergantung pada daerah terpengaruh. Infeksi pada vagina atau vulva dapat menyebabkan gatal parah, terbakar, nyeri, iritasi, dan sebuah lapisan putih atau abu-abu tipis. Gejala-gejala ini juga hadir dalam vaginosis bakteri lebih umum. Dalam sebuah penelitian tahun 2002 diterbitkan dalam Journal of Obstetri dan Ginekologi, hanya 33 % wanita yang mandiri untuk mengobati infeksi jamur sebenarnya mengalami infeksi ragi, sementara sebagian besar telah baik vaginosis bakteri atau infeksi tipe campuran. Gejala infeksi pada alat kelamin pria termasuk luka merata merah di dekat kepala penis atau di kulup, gatal parah, atau sensasi terbakar. Kandidiasis pada penis juga dapat memiliki cairan putih, meskipun jarang.

Sumber: https://ngegas.com/kakaotalk-apk/

Konsumsi Kacang Tanah Dapat Menyebabkan Asam Urat

Pakar kesehatan menjelaskan bahwa kacang tanah mempunyai poly sekali nutrisi menyehatkan. Sebagai contoh, masih ada empat kandungan primer yang sanggup kita temui pada kacang tanah, yakni protein botani, 50 persen lemak sehat yang sanggup menurunkan kadar kolesterol jahat, kandungan serat yg sanggup menyehatkan pencernaan & menjaga kadar gula arah, & kandungan vitamin B yang sangat tinggi.

Khusus buat mitos bahwa mengonsumsi kacang tanah sanggup mengakibatkan datangnya asam urat, pakar kesehatan menyebut mitos ini berawal dari adanya kandungan purin pada dalamnya.

Sebagaimana kita ketahui, purin adalah biang keladi bagi penyakit asam urat. Hanya saja, berdasarkan penelitian, kadar purin pada pada kacang-kacangan, termasuk kacang tanah nir terlalu tinggi sebagai akibatnya tetap aman buat dikonsumsi.

Alih-alih menghindari kacang tanah, kita justru harus menghindari jeroan dan makanan laut yang memiliki jumlah purin sangat tinggi sehingga bila seringkali dikonsumsi bisa menyebabkan datangnya penyakit asam urat.

Mitos lain yg menjelaskan bahwa kacang tanah bisa menyebabkan perut kembung ternyata juga tidak sahih adanya. Memang, bagi mereka yang mempunyai kasus alergi, makan kacang tanah bisa mengakibatkan reaksi yang nir nyaman.

Bahkan, dalam beberapa kasus bisa membahayakan nyawa lantaran sesak napas, lemas, hingga kehilangan kesadaran, namun bagi orang normal, makan kacang tanah tidak akan memicu perut kembung.

Mengonsumsi kacang tanah pula tidak akan mengakibatkan datangnya jerawat sebagaimana mitos yang dianggap oleh poly orang. Bahkan, dengan rajin mengonsumsi kacang tanah, kita justru sanggup menyehatkan jantung dan pembuluh darah. Hal ini disebabkan oleh tingginya kadar lemak sehat yang mampu mengendalikan kadar kolesterol & plak pada dalam pembuluh darah.

Baca Juga:

Obat Mual Muntah Paling Ampuh (Medis dan Alami)

Obat Mual Muntah Paling Ampuh (Medis dan Alami)

Mual adalah reaksi berasal dari ketidaknyamanan perut bersama sensasi dambakan memuntahkan isikan perut. Ini berjalan gara-gara bermacam penyebab seperti efek makanan, obat-obatan tertentu, atau keadaan kebugaran lainnya. Ketahui langkah mengatasinya bersama obat mual muntah secara medis dan alami.

Obat Mual Muntah Secara Medis
Terdapat bermacam penyebab mual muntah seperti perut peka pada makanan khusus dan keadaan medis seperti sakit maag, GERD, infeksi, virus, mabuk perjalanan, sakit perut, dan lainnya.

Indikasi mual dan muntah biasa sanggup ditangani bersama obat-obatan medis, seperti:

1. Promethazine
Promethazine adalah obat resep untuk mengobati sebagian indikasi seperti mual dan muntah akibat mabuk perjalanan, alergi, nyeri pasca operasi, insomnia, kecemasan sebelum akan operasi, dan bisa saja digunakan untuk indikasi lain yang tidak dicantumkan di dalam Info kebugaran ini.

Promethazine terhitung di dalam kelas obat antihistamin yang bekerja bersama langkah mencegah pelepasan zat histamin berasal dari sel-sel khusus di dalam tubuh. Zat histamin umumnya dilepaskan selagi Anda terpapar alergi yang memicu mual dan muntah.

Dosis obat promethazine untuk mabuk perjalanan adalah 25 mg yang diminum sesegera bisa saja sebelum akan Anda bepergian. Dosis ke-2 diminum pada malam hari dan dosis ketiga diminum di malam berikutnya.

Dosis obat promethazine untuk menanggulangi mual dan muntah umum adalah 25 mg di malam hari, dosis sanggup meningkat jadi 50-75 mg di malam hari, atau 25 mg 2-3 kali per hari andaikata perlu. Dosis maksimum yang diperbolehkan adalah 100 mg per hari. Hubungi dokter untuk anjuran resep dan keputusan obat yang tepat.

2. Metoclopramide
Metoclopramide adalah obat di dalam golongan antiemetik untuk mengobati gejala refluks gastroesofageal (GERD) terhitung mual, muntah, mulas, tidak nafsu makan, dan merasa kenyang lama setelah makan. Obat ini sanggup mencegah mual dan muntah bersama langkah memblokir reseptor di dalam tubuh yang memicu terjadinya mual dan muntah.

Dosis metoclopramide untuk menanggulangi mual dan muntah pada dewasa adalah 10 mg obat oral atau 0,5 mg/BBkg setiap hari. Dosis maksimal adalah 30 mg per hari bersama perawatan maksimal sepanjang 5 hari.

Terdapat sebagian style obat mual muntah lainnya secara medis cocok bersama keadaan medis yang mendasarinya. Hubungi dokter untuk anjuran resep dan keputusan obat yang tepat.

Obat Mual Alami
Setiap orang bisa saja pernah mengalami gejala mual dan muntah yang tidak menyenangkan, terhitung mual akibat mabuk perjalanan atau tanda hamil. Anda sanggup pakai obat-obatan atau memilih langkah alami menanggulangi mual dan muntah berikut ini:

1. Jahe
Jahe adalah obat herbal alami yang dipercaya sanggup menanggulangi bermacam gejala penyakit seperti mual, muntah, pilek, dan flu biasa. Berdasarkan penelitian, senyawa alami jahe miliki langkah kerja yang sama bersama obat antimual.

Jahe terhitung telah lama digunakan untuk kurangi morning sickness pada ibu hamil dan orang setelah perawatan kemoterapi atau operasi. Jahe sebagai obat mual muntah terhitung diakui tidak miliki efek samping berat dibandingkan obat medis.

Anda sanggup mengolah jahe jadi teh jahe atau susu jahe di dalam dosis harian. Jahe miliki efek menghangatkan dan menenangkan perut.

2. Lemon
Berdasarkan penelitian yang dilakukan pada 100 wanita hamil, menghirup minyak esensial lemon dan almond sanggup meredakan rasa mual secara efektif. Pada akhir penelitian di hari ke-4, gejala mual berkurang sampai 9%.

Lemon atau aroma jeruk terhitung miliki efek aromaterapi yang menenangkan dan dikaitkan sebagai agen aktif untuk membantu meredakan rasa mual di dalam bermacam kondisi.

3. Rempah-Rempah
Beberapa style rempah-rempah dipercaya sebagai pengobatan rumahan untuk menanggulangi mual dan muntah, seperti:

Bubuk Adas (fennel): Kandungan alaminya digunakan untuk menanggulangi mual, muntah, dan kurangi gejala nyeri menstruasi.
Kayu Manis: Meredakan mual dan nyeri sepanjang jaman menstruasi.
Ekstrak Jinten: Obat alami untuk menanggulangi sakit perut, nyeri, sembelit, diare, dan juga mual dan muntah.
Ketiga style rempah berikut dipercaya sebagai obat herbal, tapi penelitian lebih di dalam wajib dilakukan untuk menunjukkan manfaatnya secara medis.

4. Aromaterapi Peppermint
Anda terhitung sanggup pakai aromaterapi peppermint sebagai alternatif obat mual muntah yang efektif. Berdasarkan penelitian, aromaterapi peppermint sanggup meredakan mual sebanyak 57% persoalan dan lebih efektif berasal dari obat anti mual.

Peppermint pun diolah jadi bermacam produk seperti pil peppermint, teh peppermint, minyak esensial peppermint, dan campuran minuman lainnya untuk kegunaan kesehatan.

5. Minum Air Putih
Cara alami menanggulangi mual adalah bersama minum air putih yang cukup, gara-gara andaikata Anda dehidrasi bakal memperburuk gejala mual dan muntah. Selain itu, Anda wajib mengganti dan selalu menyuplai cairan yang kaya bakal elektrolit seperti air mineral untuk tubuh Anda.

Selain air putih, Anda terhitung direkomendasikan untuk mengonsumsi kaldu sayuran atau style elektrolit lainnya agar keadaan tubuh selalu terjaga. Jangan lupa untuk menyesuaikan napas dalam-dalam untuk membantu kurangi mual.

6. Vitamin B6
Berdasarkan penelitian, vitamin B6 atau pyridoxine adalah kandungan efektif untuk meredakan mual pada ibu hamil. Dosis vitamin B6 yang direkomendasikan adalah 200 mg per hari umumnya diakui aman sepanjang kehamilan dan hampir tidak miliki efek samping.

Tips Mengatasi Mual dan Muntah
Selain anjuran obat mual muntah di atas, berikut ini sebagian tips kurangi mual:

Jangan mengonsumsi makanan pedas atau makanan berlemak gara-gara bakal memicu sakit perut dan memperburuk gejala mual.
Hindari makan di dalam porsi besar secara langsung. Lebih baik makan di dalam porsi kecil berkali-kali agar perut tidak kaget.
Jangan rebahan atau berbaring setelah makan. Setidaknya tunggu lebih kurang 30-60 menit sampai makanan merasa dicerna.
Hindari makan sambil minum gara-gara bakal memberi tambahan sensasi telah kenyang dan memicu rasa mual kembali.
Makan makanan yang kaya bakal protein.

Itulah sebagian anjuran obat mual muntah yang efektif. Bila gejala mual memburuk dan didasari oleh penyakit lain, mau langsung hubungi dokter untuk konsultasi lebih lanjut.

Artikel Lainnya : https://penjaskes.co.id/10-teknik-dasar-sepak-bola/

Baca Juga :

Penyebab Hidung Tersumbat dan Cara Mengatasinya

Penyebab Hidung Tersumbat dan Cara Mengatasinya

Hidung tersumbat adalah suasana yang terlampau umum terjadi. Hampir tiap-tiap orang pernah mengalaminya. Meski suasana ini jarang mengakibatkan persoalan yang serius, ini adalah suasana yang sanggup mengganggu kesibukan sehari-hari. Hidung tersumbat sanggup berlangsung disaat pembuluh darah di didalam hidung meradang dan membengkak. Selain itu, drainase lendir yang berlebih juga sanggup sebabkan hidung tersumbat. Berikut ini adalah berbagai penyebab hidung tersumbat lainnya yang wajib Anda pahami. Simak penjelasan selengkapnya di bawah ini.

Penyebab Hidung Tersumbat
Pada dasarnya penyebab hidung tersumbat memiliki banyak aspek layaknya pilek, flu, dan alergi. Terkadang hidung tersumbat dan berair sanggup disebabkan oleh iritasi layaknya asap tembakau dan asap kendaraan. Kondisi ini disebut rhinitis nonalergi atau rhinitis vasomotor. Pada banyak kasus, hidung tersumbat juga sanggup disebabkan oleh tumor.

Meski begitu, didalam banyak kasus, umumnya hidung tersumbat cuma persoalan yang berlangsung kala dan bukan suasana serius. Berikut adalah berbagai suasana lain yang menjadi penyebab hidung tersumbat, di antaranya:

1. Infeksi Virus
Penyebab hidung tersumbat yang pertama dan paling umum adalah infeksi virus. Infeksi virus sebabkan seseorang mengalami pilek. Terdapat sebagian virus yang sanggup sebabkan pilek, rhinovirus adalah salah satu virus paling umum. Selain hidung tersumbat, pilek juga sanggup sebabkan bersin, sakit tenggorokan, dan batuk.

2. Rhinitis Alergi
Penyebab hidung tersumbat seterusnya sanggup disebabkan oleh rhinitis alergi. Kondisi ini berlangsung disaat proses kekebalan tubuh bereaksi terlalu berlebih terhadap suatu zat yang umumnya tidak berbahaya. Pemicu umum berasal dari rhinitis alergi juga iklim/cuaca, serbuk sari, debu, dan bulu hewan peliharaan.

Selain hidung tersumbat, gejala lain yang barangkali berlangsung adalah bersin, hidung meler, dan mata gatal. Tidak mengetahui mengapa sebagian orang mengembangkan suasana ini, tapi memiliki riwayat keluarga alergi merupakan aspek risiko yang tingkatkan suasana ini.

3. Rhinitis terhadap jaman Kehamilan
Kehamilan mempengaruhi banyak bagian tubuh, salah satunya adalah hidung. Selama kehamilan, hormon progesteron dan estrogen bakal meningkat. Peningkatan hormon seiring bersama peningkatan aliran darah sanggup sebabkan pembengkakan selaput lendir di didalam hidung. Gejala yang barangkali berlangsung adalah hidung tersumbat dan bersin.

4. Rhinitis Atrofi
Rinitis atrofi berlangsung disaat tersedia penipisan dan pengerasan selaput lendir di didalam hidung. Jaringan yang menipis memudahkan bakteri untuk tumbuh dan sebabkan infeksi.

5. Sinusitis
Sinusitis kronis ternyata sanggup menjadi penyebab hidung tersumbat. Kondisi ini berlangsung disaat pembengkakan dan peradangan berlangsung terhadap sinus selama tiga bulan atau lebih. Selain itu, suasana ini juga menganggu langkah lendir mengalir, supaya sebabkan hidung tersumbat. Area sekitar mata juga barangkali terasa bengkak.

Selain sinusitis kronis, penyebab hidung tersumbat juga sanggup berlangsung akibat sinusitis akut. Kondisi ini sebagian besar disebabkan oleh flu biasa. Sebagian besar persoalan pulih didalam seminggu sampai 10 hari bersama pengobatan rumahan.

6. Deviasi Septum
Deviasi septum adalah suatu suasana di mana nasal septum—dinding tidak tebal yang membagi rongga hidung, mengalami pembengkokan ke salah satu sisi rongga hidung supaya sebabkan hidung tersumbat. Banyak orang tidak mengetahui bahwa mereka memiliki semacam ketidaksejajaran sekat hidung (nasal septum) ini. Pada persoalan yang jarang, ketidaksejajaran septum yang kronis sanggup sebabkan persoalan pernapasan yang lumayan penting dikemudian hari.

7. Polip Hidung
Polip hidung adalah tumor jinak (nonkanker) yang tumbuh berasal dari susunan hidung atau sinus. Polip ini umumnya berlangsung di saluran hidung kanan dan kiri dan menghambat aliran udara. Kondisi ini sanggup sebabkan hidung terasa pengap dan sanggup mengurangi indra penciuman.

Meskipun sering berlangsung tanpa alasan yang jelas, polip hidung sanggup berlangsung akibat peradangan kronis terhadap susunan hidung. Seseorang bersama rhinitis alergi lebih barangkali mengembangkan suasana ini. Selain itu, polip hidung umumnya berkembang terhadap anak-anak bersama fibrosis kistik.

8. Occupational Asthma
Occupational asthma adalah type asma yang terkait bersama perkerjaan. Hal ini ini barangkali berlangsung akibat pekerjaan yang terkait bersama asap/gas kimia, debu, material atau logam lainnya yang mengharuskan kontak bersama materi tersebut tiap-tiap hari.

9. Respiratory Syncytial Virus (RSV)
RSV adalah suasana yang sebabkan infeksi paru-paru dan saluran pernapasan. Kondisi ini banyak berlangsung terhadap anak-anak usia 2 tahun. Namun tidak menutup barangkali virus ini juga sanggup menginfeksi orang dewasa. RSV memiliki gejala yang mudah dan mirip flu biasa.

Meski begitu, RSV sanggup sebabkan infeksi kronis terhadap bayi prematur, lansia, seseorang bersama penyakit jantung, paru-paru, dan proses kekebalan tubuh yang lemah.

Cara Mengatasi Hidung Tersumbat
Setelah Anda mengetahui berbagai penyebab hidung tersumbat layaknya di atas, hal mutlak lainnya yang wajib Anda ketahui adalah bagaimana langkah menanggulangi hidung tersumbat. Berikut ini adalah sebagian langkah yang sanggup dilakukan, di antaranya:

Mengirigasi Bagian didalam Hidung
Irigasi bagian didalam hidung sanggup dilakukan bersama nasal irrigation kit atau neti pot. Cara ini efektif untuk bersihkan lendir dan sebabkan pernapasan lebih lancar. Air yang digunakan untuk irigasi terdiri berasal dari 1 cangkir air hangat ,yang dicampurkan bersama sedikit soda kue, dan 1/2 sendok teh garam lantas dialirkan (irigasikan) berasal dari 1 rongga hidung ke rongga hidung lainnya.. Guna memperoleh hasil yang terbaik, jalankan pembilasan 1 sampai 2 kali sehari.

Menggunakan Uap
Cara menanggulangi hidung tersumbat ini sanggup dilakukan bersama mandi air panas atau konsumsi secangkir teh panas. Uap sanggup mengencerkan lendir dan membantunya mengalir berasal dari hidung. Selain itu, Anda juga sanggup menuangkan air mendidih ke didalam mangkuk, lantas tutup kepala bersama handuk serta condongkan badan ke mangkok lantas hirup uap panasnya. Cara ini sanggup dilakukan tiga sampai empat kali sehari untuk mengurangi gejala hidung tersumbat.

Penuhi Kebutuhan Cairan Tubuh
Cara menanggulangi hidung tersumbat seterusnya yang paling mudah dilakukan adalah bersama mencukupi keperluan cairan tubuh. Minum banyak cairan bakal mengencerkan lendir, di mana hal itu sanggup mendukung menghambat terjadinya penyumbatan sinus.

Menggunakan Nasal Saline Spray
Merupakan semprotan hidung yang mengandung cairan saline, yang mendukung merawat kelembaban rongga hidung. Semprotan ini biasa direkomendasikan dokter untuk orang yang mengalami sumbatan hidung yang disebabkan oleh lingkungan tempat kerja/ tinggal yang dingin atau ber-AC.

Menggunakan Humidifier
Humidifier merupakan alat yang digunakan untuk merawat kestabilan kelembaban udara terhadap suatu ruangan tertentu. Penggunaan alat ini sanggup mendukung mengurangi gejala hidung tersumbat bersama langkah memecah lendir, dan meredakan saluran hidung yang meradang. Namun, terkecuali Anda menderita asma, konsultasikan bersama dokter sebelum akan pakai pelembap udara.

Obat golongan ini sanggup mendukung mengurangi pembengkakan di saluran hidung dan meredakan hidung tersumbat yang biasa berlangsung terhadap rhinitis alergi atau sinusitis.

Jika sinusitis dan alergi disebabkan oleh alergi, obat-obat golongan antihistamin sanggup mendukung mengendalikan dan mengurangi gejala hidung tersumbat. Obat ini umumnya diberikan bersama bersama obat dekongestan

Baca Juga :




Gentamicin sulfat

merupakan antibiotik aminoglikosida spektrum luas yang larut dalam air dan mempunyai sifat memperlambat pertumbuhan atau membunuh kuman-kuman gram-positif maupun kuman gram-negatif termasuk kuman-kuman yang resisten terhadap antimikroba lain, seperti Staphylococcus penghasil penisilinase; Pseudomonas aeruginosa; Proteus; Klebsiella; E.coli.

Gentamicin sebenarnya berasal dari jamur Micromonospora purpurea dan bekerja dengan cara berikatan secara irreversibel dengan sub unit 30Sdari ribosom bakteri, sehingga menghambat sintesis protein dengan menghambat pergerakkan peptidyl-t RNA yang berhubungan dengan translokasi,juga meningkatkan frekuensi salah baca dari nilai kode genetik sampai interaksi kodon-antikodon yang tidak tepat. Konsentrasi dalam darah yang direkomendasikan agar gentamicin dapat bekerja optimal adalah 0.5 to 50 µg / ml.


Gentamicin topikal untuk kulit digunakan dalam pengobatan infeksi kulit primer maupun sekunder seperti impetigo kontagiosa, ektima, furunkulosis. pioderma, psoriasis dan macam-macam dermatitis lainnya.

Kontra Indikasi:

Alergi terhadap gentamicin.

Peringatan dan Perhatian: 

Penggunaan antibiotika topikal kadang-kadang menyebabkan suburnya pertumbuhan mikroorganisme yang tidak sensitif terhadap antibiotika, seperti jamur.
Bila hal ini terjadi atau terdapat iritasi, sesitisasi atau superinfeksi, pengobatan dengan Gentamicin harus dihentikan dan harus diberi terapi pengganti yang tepat. 

  • Gentamicin topikal untuk kulit, tidak diperbolehkan untuk pengobatan mata.
  • Obat-obat bakterisid tidak efektif terhadap infeksi kulit yang disebabkan virus dan jamur.
  • Keamanan pemakaian Gentamicin pada wanita hamil secara absolut belum dipastikan, tidak boleh digunakan pada wanita hamil dalam jumlah yang banyak atau periode waktu yang lama.
  • Ototoxicity dan nephrotoxicity yang kemungkinan besar dapat terjadi pada pasien geriatrik dan pasien yang mengalami dehidrasi, pada pasien yang menerima dosis tinggi atau yang melakukan pengobatan dalam jangka panjang, mereka yang juga menerima atau yang telah menerima obat ototoxic ataunephrotoxic lainnya. (Perhatikan pengawasan konsentrasi serum dan atau puncak konsentrasi serum/rasio MIC pada pasien ini). Konsentrasi dalam serum yang berlebihan hingga melebihi 12 µg/ml, untuk jangka waku yang lama dapat mengakibatkan efek samping ototoksik. Konsentrasi dalam serum yang berlebihan ini terutama diakibatkan oleh karena kelainan unuk menyesuaikan dosis dengan eliminasi melalui ginjal yang berkurang, seperti pada keadaan–keadaan gangguan fungsi ginjal.
  • Gunakan dengan hati-hati pada pasien dengan kondisi yang berhubungan dengan kelemahan otot (misalnya myasthenia gravis, penyakit Parkinson), pasien yang telah memiliki disfungsi ginjal, kerusakan vestibular atau cochlear.

 Efek Samping: 

Topikal : Iritasi ringan, eritema dan pruritus.
Sistemik : 

  • Efek ototoxic (bisa menyebabkan ototoxicity yang bersifat permanen, berupa kehilangan pendengaran, kepeningan, vertigo); 
  • Efek renal (nephrotoxicity yang yang bersifat reversibel, gagal ginjal akut dilaporkan terjadi biasanya ketika obat nephrotoxiclainnya juga diberikan); 
  • Efek neuromuskular (penghambatan neuromuskular yang menghasilkan depresi berturut-turut dan paralisis muskuler); reaksi hipersensitivitas. 
  • Efek samping lain yang mungkin timbul adalah ruam kulit, demam, gangguan saluran cerna, sakit kepala.

Cara Penyimpanan:  

Dalam wadah tertutup rapat. Terlindung dari pengaruh panas yang berlebihan.


Baca Artikel Lainnya: